General Information

  • ID:  hor001890
  • Uniprot ID:  P48143
  • Protein name:  Vasoactive intestinal peptide
  • Gene name:  VIP
  • Organism:  Gallus gallus (Chicken)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0001938 positive regulation of endothelial cell proliferation; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway; GO:0007611 learning or memory; GO:0032812 positive regulation of epinephrine secretion; GO:0032880 regulation of protein localization; GO:0043066 negative regulation of apoptotic process; GO:0043267 negative regulation of potassium ion transport; GO:0045732 positive regulation of protein catabolic process; GO:0048242 epinephrine secretion; GO:0048255 mRNA stabilization; GO:0048662 negative regulation of smooth muscle cell proliferation; GO:0060406 positive regulation of penile erection; GO:0070459 prolactin secretion
  • GO CC:  GO:0005576 extracellular region; GO:0043005 neuron projection

Sequence Information

  • Sequence:  HSDAVFTDNYSRFRKQMAVKKYLNSVLT
  • Length:  28(129-156)
  • Propeptide:  MEHRGASPLLLALALLSALCWRARALPPRGAAFPAVPRLGNRLPFDAASESDRAHGSLKSESDILQNTLPENEKFYFDLSRIIDRNARHADGIFTSVYSHLLAKLAVKRYLHSLIRKRVSSQDSPVKRHSDAVFTDNYSRFRKQMAVKKYLNSVLTGKRSQEELNPAKLRGEAEILEPSFSENYDDVSVDELLSHLPLDL
  • Signal peptide:  MEHRGASPLLLALALLSALCWRARA
  • Modification:  T28 Threonine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Cause vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  VIPR2
  • Target Unid:  Q56IA1
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P48143-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001890_AF2.pdbhor001890_ESM.pdb

Physical Information

Mass: 380155 Formula: C148H232N42O43S
Absent amino acids: CEGIPW Common amino acids: KSV
pI: 10.32 Basic residues: 6
Polar residues: 9 Hydrophobic residues: 9
Hydrophobicity: -58.93 Boman Index: -6914
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 66.07
Instability Index: 2803.57 Extinction Coefficient cystines: 2980
Absorbance 280nm: 110.37

Literature

  • PubMed ID:  1227973
  • Title:  Structure of the vasoactive intestinal octacosapeptide from chicken intestine. The amino acid sequence.